PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr010042.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 353aa    MW: 40242.5 Da    PI: 9.7542
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr010042.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.8e-181560147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
      Pbr010042.1 15 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 60
                     899*****************************.***********996 PP

2Myb_DNA-binding58.81.3e-1867110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
      Pbr010042.1  67 RRPFSEEEEERLLAAHRIHGNK-WALIARLFP-GRTDNAVKNHWHV 110
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3161061IPR017930Myb domain
SuperFamilySSF466891.39E-2913108IPR009057Homeodomain-like
SMARTSM007178.4E-151463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-271668IPR009057Homeodomain-like
CDDcd001675.89E-141859No hitNo description
PfamPF139212.1E-171878No hitNo description
PROSITE profilePS5129427.44162116IPR017930Myb domain
SMARTSM007174.9E-1666114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2169114IPR009057Homeodomain-like
CDDcd001671.05E-778109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MEDYGDEAKS TGCPRGHWRP AEDEKLRQLV EQYGAQNWNS IAEKLQGRSG KSCRLRWFNQ  60
LDPRINRRPF SEEEEERLLA AHRIHGNKWA LIARLFPGRT DNAVKNHWHV IMARRQREQS  120
KVCGKKSFQD FFNDHSPNSS SISNNFDAGR KLRSQGSSIG FGRNNISTKF FEFQNLNKDR  180
AMFMDSRPTS SLPYNWSFAS MPTTSNKSSS SVDLLGRERR EYINNGNSNY TISELSKGSH  240
PQLVHRRHNP TSSFLYGCYR GSSSNAFGRP TYSSPFGCPG NLADHHINRQ DQHGSTFKEV  300
LPNLYENAST LPKWRVAATT TKFDDHDPQD HVSIDHHKET PFIDFLGVGI SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31151157107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368396.10.0PREDICTED: transcription factor MYB44-like
TrEMBLM5VN751e-175M5VN75_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s20870.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-62myb domain protein 52